PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI12G05190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 299aa    MW: 31883.5 Da    PI: 8.2378
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI12G05190.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-174794148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+  ++q+G g+W++ ++  g+ R++k+c++rw +yl
  ORUFI12G05190.1 47 KGAWTKEEDQRLIAHINQHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 94
                     79******************************99************97 PP

2Myb_DNA-binding59.76.5e-19100144147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T eEdel+++++++lG++ W++Ia +++ gRt++++k++w+++
  ORUFI12G05190.1 100 RGNFTDEEDELIIKLHELLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 144
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-243897IPR009057Homeodomain-like
PROSITE profilePS5129416.5314294IPR017930Myb domain
SMARTSM007178.1E-144696IPR001005SANT/Myb domain
SuperFamilySSF466891.29E-2946141IPR009057Homeodomain-like
PfamPF002493.5E-154794IPR001005SANT/Myb domain
CDDcd001672.65E-114994No hitNo description
PROSITE profilePS5129429.11695149IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2898149IPR009057Homeodomain-like
SMARTSM007174.9E-1899147IPR001005SANT/Myb domain
PfamPF002496.1E-17100144IPR001005SANT/Myb domain
CDDcd001671.94E-13102145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MHINSSSLSS PSSSSPLSTT IVVVAVFLSS IGAMGRSPCC EKAHTNKGAW TKEEDQRLIA  60
HINQHGEGCW RSLPKAAGLL RCGKSCRLRW INYLRPDLKR GNFTDEEDEL IIKLHELLGN  120
KWSLIAGRLP GRTDNEIKNY WNTHIKRKLL ARGLDPLTHR PLNAAAAVAG HHHLAAGGSS  180
CSPDATSGHS SCSDGDEYRG GIDLNLSISP PSSSSQPSSP PPPSHEAEAR RAGATASYTY  240
HHHYSETREK ICLCLNHLGL HGGDECSCGG SSASSSSSPP PATASSRAFT FANASSSTV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-304614926128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankD886180.0D88618.1 Oryza sativa mRNA for OSMYB2, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618922.10.0PREDICTED: myb-related protein 308
SwissprotP813932e-89MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A0E0REG70.0A0A0E0REG7_ORYRU; Uncharacterized protein
STRINGLOC_Os12g07640.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.13e-86myb domain protein 4